Structure of PDB 1r1p Chain D Binding Site BS01

Receptor Information
>1r1p Chain D (length=95) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDV
QHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r1p Structural basis for differential recognition of tyrosine-phosphorylated sites in the linker for activation of T cells (LAT) by the adaptor Gads.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R67 R85 S87 S89 S95 Q105 H106 F107 K108 L119 W120
Binding residue
(residue number reindexed from 1)		R13 R31 S33 S35 S41 Q51 H52 F53 K54 L65 W66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1r1p, PDBe:1r1p, PDBj:1r1p
PDBsum1r1p
PubMed15029250
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]