Structure of PDB 1qd6 Chain D Binding Site BS01

Receptor Information
>1qd6 Chain D (length=239) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLYPYDTNYLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRG
ILGPNSVLGASYTQKSWWQLSNSEESSPFRETNYEPQLFLGFATDYRFAG
WTLRDVEMGYNHDSNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVVG
NTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGYGGAELGLSYP
ITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
Ligand information
>1qd6 Chain B (length=13) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVRGSIIANMLQE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qd6 Structural evidence for dimerization-regulated activation of an integral membrane phospholipase.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y33 Y35 R79 F119 A123 D135 M163 H202 F269
Binding residue
(residue number reindexed from 1)		Y3 Y5 R49 F89 A93 D105 M133 H172 F239
Enzymatic activity
Catalytic site (original residue number in PDB) S106 H142 S144 G146 R147 S152 N156
Catalytic site (residue number reindexed from 1) S76 H112 S114 G116 R117 S122 N126
Enzyme Commision number 3.1.1.32: phospholipase A1.
3.1.1.4: phospholipase A2.
Gene Ontology
Molecular Function
GO:0004620 phospholipase activity
Biological Process
GO:0006629 lipid metabolic process
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1qd6, PDBe:1qd6, PDBj:1qd6
PDBsum1qd6
PubMed10537112
UniProtP0A921|PA1_ECOLI Phospholipase A1 (Gene Name=pldA)

[Back to BioLiP]