Structure of PDB 1pyu Chain D Binding Site BS01

Receptor Information
>1pyu Chain D (length=91) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGA
AAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK
Ligand information
>1pyu Chain A (length=28) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PRGSMIRTMLQGKLHRVKVTHADLHYEG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pyu Structural Constraints on protein self-processing in L-aspartate-alpha-decarboxylase
Resolution1.9 Å
Binding residue
(original residue number in PDB)		G37 L39 N41 E42 A43 Y58 V91 T92 P94 E97
Binding residue
(residue number reindexed from 1)		G13 L15 N17 E18 A19 Y34 V67 T68 P70 E73
Enzymatic activity
Catalytic site (original residue number in PDB) C25 Y58
Catalytic site (residue number reindexed from 1) C1 Y34
Enzyme Commision number 4.1.1.11: aspartate 1-decarboxylase.
Gene Ontology
Molecular Function
GO:0004068 aspartate 1-decarboxylase activity
Biological Process
GO:0006523 alanine biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pyu, PDBe:1pyu, PDBj:1pyu
PDBsum1pyu
PubMed14633979
UniProtP0A790|PAND_ECOLI Aspartate 1-decarboxylase (Gene Name=panD)

[Back to BioLiP]