Structure of PDB 1ox9 Chain D Binding Site BS01

Receptor Information
>1ox9 Chain D (length=108) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVL
NIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTM
FEPEAAYD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ox9 Structural basis of degradation signal recognition by SspB, a specificity-enhancing factor for the ClpXP proteolytic machine
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y45 V52 N54 R58 A59 G61 N73 A74 R75 F76 G78 R96
Binding residue
(residue number reindexed from 1)		Y42 V49 N51 R55 A56 G58 N70 A71 R72 F73 G75 R93
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1ox9, PDBe:1ox9, PDBj:1ox9
PDBsum1ox9
PubMed12887894
UniProtP0AFZ3|SSPB_ECOLI Stringent starvation protein B (Gene Name=sspB)

[Back to BioLiP]