Structure of PDB 1o9k Chain D Binding Site BS01

Receptor Information
>1o9k Chain D (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYE
LMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVL
IKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1o9k Crystal Structure of the Retinoblastoma Tumor Suppressor Protein Bound to E2F and the Molecular Basis of its Regulation
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T645 L649 K653 R656
Binding residue
(residue number reindexed from 1)		T2 L6 K10 R13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1o9k, PDBe:1o9k, PDBj:1o9k
PDBsum1o9k
PubMed12598654
UniProtP06400|RB_HUMAN Retinoblastoma-associated protein (Gene Name=RB1)

[Back to BioLiP]