Structure of PDB 1nkk Chain D Binding Site BS01

Receptor Information
>1nkk Chain D (length=220) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEQQSQAVAPVYVGGFLARYDQSPDEARLLLPRDVVEHWLHAQVALPLNI
NHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGP
VSPLQPDKVVEFLSGSYAGLSLSSRRTPFKHVALCSVGRRRGTLAVYGRD
PEWVTQRFPDLTAADRDGLRAQWQGDPFRSDSYGLLGNSVDALYIRERLP
KLRYDKQLVGVTERESYVKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nkk Structural and Biochemical Studies of Inhibitor Binding to Human Cytomegalovirus Protease
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R1331 H1363 S1432 L1433 S1434 S1435 R1437 G1464 R1465
Binding residue
(residue number reindexed from 1)		R28 H52 S121 L122 S123 S124 R126 G138 R139
Enzymatic activity
Catalytic site (original residue number in PDB) H1363 S1432 S1434 H1457 R1465 R1466
Catalytic site (residue number reindexed from 1) H52 S121 S123 H131 R139 R140
Enzyme Commision number 3.4.21.97: assemblin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1nkk, PDBe:1nkk, PDBj:1nkk
PDBsum1nkk
PubMed12549906
UniProtP16753|SCAF_HCMVA Capsid scaffolding protein (Gene Name=UL80)

[Back to BioLiP]