Structure of PDB 1njt Chain D Binding Site BS01

Receptor Information
>1njt Chain D (length=223) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAVALPLNIN
HDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPV
SPLQPDKVVEFLSGSYAGLSLSSRRCTTPFKHVALCSVGRRRGTLAVYGR
DPEWVTQRFPDLTAADRDGLRAQWQASGDPFRSDSYGLLGNSVDALYIRE
RLPKLRYDKQLVGVTERESYVKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1njt Structural and Biochemical Studies of Inhibitor Binding to Human Cytomegalovirus Protease
Resolution2.5 Å
Binding residue
(original residue number in PDB)		E1331 H1363 S1432 L1433 S1434 S1435 R1436 R1437 G1464 R1465
Binding residue
(residue number reindexed from 1)		E28 H51 S120 L121 S122 S123 R124 R125 G139 R140
Enzymatic activity
Catalytic site (original residue number in PDB) H1363 S1432 S1434 H1457 R1465 R1466
Catalytic site (residue number reindexed from 1) H51 S120 S122 H132 R140 R141
Enzyme Commision number 3.4.21.97: assemblin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1njt, PDBe:1njt, PDBj:1njt
PDBsum1njt
PubMed12549906
UniProtP16753|SCAF_HCMVA Capsid scaffolding protein (Gene Name=UL80)

[Back to BioLiP]