Structure of PDB 1n4s Chain D Binding Site BS01

Receptor Information

>1n4s Chain D (length=346) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVV
NKDDIIEWIYSLQVLPTEDRSNLDRCGFRGSSYLGIPFNPSKNPGTAHPY
DSGHIAMTYTGLSCLIILGDDLSRVDKEACLAGLRALQLEDGSFCAVPEG
SENDMRFVYCASCICYMLNNWSGMDMKKAISYIRRSMSYDNGLAQGAGLE
SHGGSTFCGIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKP
VDTCYSFWVGATLKLLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHP
DALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQSWKT

Ligand information

>1n4s Chain N (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CVIL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1n4s Structure of mammalian protein geranylgeranyltransferase type-I
Resolution	2.6 Å
Binding residue (original residue number in PDB)	R173 L320
Binding residue (residue number reindexed from 1)	R156 L303

Enzymatic activity

Catalytic site (original residue number in PDB)	H219 R263 K266 D269 C271 Y272 K311 D318 H321
Catalytic site (residue number reindexed from 1)	H202 R246 K249 D252 C254 Y255 K294 D301 H304
Enzyme Commision number	2.5.1.59: protein geranylgeranyltransferase type I.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0004659	prenyltransferase activity
GO:0004661	protein geranylgeranyltransferase activity
GO:0004662	CAAX-protein geranylgeranyltransferase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0008318	protein prenyltransferase activity
GO:0036094	small molecule binding
GO:0042277	peptide binding
GO:0046872	metal ion binding
GO:1901363	heterocyclic compound binding

	Biological Process
GO:0008284	positive regulation of cell population proliferation
GO:0018344	protein geranylgeranylation
GO:0034097	response to cytokine
GO:0045787	positive regulation of cell cycle
GO:0051771	negative regulation of nitric-oxide synthase biosynthetic process

	Cellular Component
GO:0005953	CAAX-protein geranylgeranyltransferase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1n4s, PDBe:1n4s, PDBj:1n4s
PDBsum	1n4s
PubMed	14609943
UniProt	P53610\|PGTB1_RAT Geranylgeranyl transferase type-1 subunit beta (Gene Name=Pggt1b)

[Back to BioLiP]