Structure of PDB 1mpj Chain D Binding Site BS01

Receptor Information
>1mpj Chain D (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
>1mpj Chain B (length=28) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VNQHLCGSHLVEALYLVCGERGFFYTPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mpj X-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben, and phenol.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		G8 V12 E13 Y16 R22 G23 F24 F25 Y26
Binding residue
(residue number reindexed from 1)		G8 V12 E13 Y16 R22 G23 F24 F25 Y26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1mpj, PDBe:1mpj, PDBj:1mpj
PDBsum1mpj
PubMed7492558
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]