Structure of PDB 1mow Chain D Binding Site BS01

Receptor Information
>1mow Chain D (length=248) Species: 2275,3055 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIWGDGGLYKLKYKGNRSEYRVVITQKSENLIKQFIAP
RMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNGN
RFLAYLAGIVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTERRWFLDK
LVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLNFKQKQANLVLK
IIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLDSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mow Design, Activity and Structure of a Highly Specific Artificial Endonuclease
Resolution2.4 Å
Binding residue
(original residue number in PDB)		G520 D521 G522 Y525 Y529 K530 R533 R537 T541 Q542 K543 T576 R577 S629 Y630 K631 Q635 R665 R667 E677 I678 K713 K736 T737
Binding residue
(residue number reindexed from 1)		G16 D17 G18 Y21 Y25 K26 R29 R33 T37 Q38 K39 T72 R73 S125 Y126 K127 Q131 R161 R163 E173 I174 K209 K232 T233
Enzymatic activity
Catalytic site (original residue number in PDB) G616 D617
Catalytic site (residue number reindexed from 1) G112 D113
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mow, PDBe:1mow, PDBj:1mow
PDBsum1mow
PubMed12419232
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI;
P21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]