Structure of PDB 1mnm Chain D Binding Site BS01

Receptor Information
>1mnm Chain D (length=77) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGL
ENLMKNTSLSRIQIKNWVSNRRRKEKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mnm Crystal structure of the yeast MATalpha2/MCM1/DNA ternary complex.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		Y131 R132 H134 R185
Binding residue
(residue number reindexed from 1)		Y19 R20 H22 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1mnm, PDBe:1mnm, PDBj:1mnm
PDBsum1mnm
PubMed9490409
UniProtP0CY08|MTAL2_YEAST Mating-type protein ALPHA2 (Gene Name=MATALPHA2)

[Back to BioLiP]