Structure of PDB 1mk9 Chain D Binding Site BS01

Receptor Information

>1mk9 Chain D (length=192) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPG
FLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTY
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKR
WAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL

Ligand information

>1mk9 Chain A (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MWDTANNPLYKEA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mk9 Structural Determinants of Integrin Recognition by Talin
Resolution	2.8 Å
Binding residue (original residue number in PDB)	T354 N355 I356 K357 R358 W359 A360 F370 Y377
Binding residue (residue number reindexed from 1)	T146 N147 I148 K149 R150 W151 A152 F162 Y169

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0005856	cytoskeleton

View graph for
Cellular Component

External links

PDB	RCSB:1mk9, PDBe:1mk9, PDBj:1mk9
PDBsum	1mk9
PubMed	12535520
UniProt	P54939\|TLN1_CHICK Talin-1 (Gene Name=TLN1)

[Back to BioLiP]