Structure of PDB 1mhc Chain D Binding Site BS01

Receptor Information
>1mhc Chain D (length=276) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFHTAVSRPGRGEPQYISVGYVDDVQFQRCDSIEEIPRMEPRAP
WMEKERPEYWKELKLKVKNIAQSARANLRTLLRYYNQSEGGSHILQWMVS
CEVGPDMRLLGAHYQAAYDGSDYITLNEDLSSWTAVDMVSQITKSRLESA
GTAEYFRAYVEGECLELLHRFLRNGKEILQRADPPKAHVAHHPRPKGDVT
LRCWALGFYPADITLTWQKDEEDLTQDMELVETRPSGDGTFQKWAAVVVP
SGEEQRYTCYVHHEGLTEPLALKWRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mhc Nonclassical binding of formylated peptide in crystal structure of the MHC class Ib molecule H2-M3
Resolution2.1 Å
Binding residue
(original residue number in PDB)
Y7 H9 I70 S73 A74 N77 T80 Y84 W97 V99 Y114 Y123 V139 T143 R146 F156 Y159
Binding residue
(residue number reindexed from 1)
Y7 H9 I70 S73 A74 N77 T80 Y84 W97 V99 Y114 Y123 V139 T143 R146 F156 Y159
Enzymatic activity
Enzyme Commision number ?
External links