Structure of PDB 1m8v Chain D Binding Site BS01

Receptor Information
>1m8v Chain D (length=71) Species: 29292 (Pyrococcus abyssi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGE
VVKRYGKIVIRGDNVLAISPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m8v Crystal Structure of Pyrococcus abyssii Sm core and its Complex with RNA: Common Features of RNA-binding in Archaea and Eukarya
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R404 P405 L406 D407 H410 Y434
Binding residue
(residue number reindexed from 1)		R2 P3 L4 D5 H8 Y32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0120114 Sm-like protein family complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m8v, PDBe:1m8v, PDBj:1m8v
PDBsum1m8v
PubMed12409299
UniProtQ9V0Y8|RUXX_PYRAB Putative snRNP Sm-like protein (Gene Name=PYRAB06500)

[Back to BioLiP]