Structure of PDB 1m5a Chain D Binding Site BS01

Receptor Information
>1m5a Chain D (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m5a The high-resolution structure of hexameric T6 cobalt insulin: A possible pathway for the T to R transition.
Resolution1.2 Å
Binding residue
(original residue number in PDB)		F1 N3 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 A30
Binding residue
(residue number reindexed from 1)		F1 N3 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 A30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m5a, PDBe:1m5a, PDBj:1m5a
PDBsum1m5a
PubMed
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]