Structure of PDB 1llm Chain D Binding Site BS01

Receptor Information
>1llm Chain D (length=85) Species: 10090,559292 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH
RDIQHILPILEDKVEELLSKNYHLENEVARLKKLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1llm Structure of a designed dimeric zinc finger protein bound to DNA.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		R211 S214 R215 H218 H222 T225 R239 F241 R243 E246 R249 H250 Q254
Binding residue
(residue number reindexed from 1)		R11 S14 R15 H18 H22 T25 R39 F41 R43 E46 R49 H50 Q54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1llm, PDBe:1llm, PDBj:1llm
PDBsum1llm
PubMed14621985
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4);
P08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]