Structure of PDB 1kl5 Chain D Binding Site BS01

Receptor Information
>1kl5 Chain D (length=119) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITGTWYNQLGSTFIVTAGADGALTGTYIGARGNAESRYVLTGRYDSAPA
TDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTT
EANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kl5 Improved affinity of engineered streptavidin for the Strep-tag II peptide is due to a fixed open conformation of the lid-like loop at the binding site.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		A46 Y54 W79 R84 S88 T90 W92 W108
Binding residue
(residue number reindexed from 1)		A31 Y39 W64 R69 S73 T75 W77 W93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1kl5, PDBe:1kl5, PDBj:1kl5
PDBsum1kl5
PubMed11910031
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]