Structure of PDB 1kl3 Chain D Binding Site BS01

Receptor Information

>1kl3 Chain D (length=119) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GITGTWYNQLGSTFIVTAGADGALTGTYVTARGNAESRYVLTGRYDSAPA
TDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTT
EANAWKSTLVGHDTFTKVK

Ligand information

>1kl3 Chain E (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SHPQFE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1kl3 Improved affinity of engineered streptavidin for the Strep-tag II peptide is due to a fixed open conformation of the lid-like loop at the binding site.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	W120 K121
Binding residue (residue number reindexed from 1)	W105 K106

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:1kl3, PDBe:1kl3, PDBj:1kl3
PDBsum	1kl3
PubMed	11910031
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]