Structure of PDB 1i51 Chain D Binding Site BS01

Receptor Information
>1i51 Chain D (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQI
LTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i51 Structural basis of caspase-7 inhibition by XIAP.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		Y230 R233 P235 R237 S275 Q276 D279 H281 F282
Binding residue
(residue number reindexed from 1)		Y19 R22 P24 R26 S64 Q65 D68 H70 F71
Enzymatic activity
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1i51, PDBe:1i51, PDBj:1i51
PDBsum1i51
PubMed11257230
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]