Structure of PDB 1hy2 Chain D Binding Site BS01

Receptor Information
>1hy2 Chain D (length=123) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hy2 Conformational Ensemble Analysis of Ligand Binding in Streptavidin Mini-Protein Complexes
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N49 E51 Y54 W79 R84 T90 W108
Binding residue
(residue number reindexed from 1)		N37 E39 Y42 W67 R72 T78 W96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1hy2, PDBe:1hy2, PDBj:1hy2
PDBsum1hy2
PubMed
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]