Structure of PDB 1hxy Chain D Binding Site BS01

Receptor Information
>1hxy Chain D (length=212) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGN
DLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNS
EKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYK
IYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKS
DDISHIDVNLYT
Ligand information
>1hxy Chain C (length=13) Species: 385585 (Influenza A virus (A/equine/Jilin/1/1989(H3N8))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKYVKQNTLKLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hxy Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
Resolution2.6 Å
Binding residue
(original residue number in PDB)		W115 Q120 N210
Binding residue
(residue number reindexed from 1)		W114 Q119 N209
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042289 MHC class II protein binding
GO:0042608 T cell receptor binding
GO:0046872 metal ion binding
GO:0090729 toxin activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hxy, PDBe:1hxy, PDBj:1hxy
PDBsum1hxy
PubMed11432818
UniProtP0A0M0|ETXH_STAAU Enterotoxin type H (Gene Name=entH)

[Back to BioLiP]