Structure of PDB 1hkn Chain D Binding Site BS01

Receptor Information
>1hkn Chain D (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKST
ETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFV
GLKKNGSCKRGPRTHYGQKAILFLPLPVS
Ligand information
Ligand IDN2M
InChIInChI=1S/C10H9NO3S/c11-10-3-1-2-7-6-8(15(12,13)14)4-5-9(7)10/h1-6H,11H2,(H,12,13,14)
InChIKeyUWPJYQYRSWYIGZ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341Nc1cccc2cc(ccc12)[S](O)(=O)=O
ACDLabs 10.04O=S(=O)(O)c1ccc2c(c1)cccc2N
OpenEye OEToolkits 1.5.0c1cc2cc(ccc2c(c1)N)S(=O)(=O)O
FormulaC10 H9 N O3 S
Name5-AMINO-NAPHTALENE-2-MONOSULFONATE
ChEMBLCHEMBL1234578
DrugBankDB08238
ZINCZINC000001680645
PDB chain1hkn Chain D Residue 5139 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hkn Leads for Development of New Naphthalenesulfonate Derivatives with Enhanced Antiangiogenic Activity: Crystal Structure of Acidic Fibroblast Growth Factor in Complex with 5-Amino-2-Naphthalenesulfonate
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N4018 K4113 K4118 Q4127 K4128
Binding residue
(residue number reindexed from 1)		N9 K104 K109 Q118 K119
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005104 fibroblast growth factor receptor binding
GO:0005178 integrin binding
GO:0005515 protein binding
GO:0008083 growth factor activity
GO:0008201 heparin binding
GO:0030544 Hsp70 protein binding
GO:0044548 S100 protein binding
Biological Process
GO:0001525 angiogenesis
GO:0001759 organ induction
GO:0007165 signal transduction
GO:0008284 positive regulation of cell population proliferation
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0009653 anatomical structure morphogenesis
GO:0009887 animal organ morphogenesis
GO:0010595 positive regulation of endothelial cell migration
GO:0010628 positive regulation of gene expression
GO:0030154 cell differentiation
GO:0030324 lung development
GO:0030334 regulation of cell migration
GO:0030335 positive regulation of cell migration
GO:0032148 activation of protein kinase B activity
GO:0034605 cellular response to heat
GO:0042060 wound healing
GO:0043406 positive regulation of MAP kinase activity
GO:0045542 positive regulation of cholesterol biosynthetic process
GO:0045766 positive regulation of angiogenesis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050673 epithelial cell proliferation
GO:0050679 positive regulation of epithelial cell proliferation
GO:0051781 positive regulation of cell division
GO:0060681 branch elongation involved in ureteric bud branching
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0072163 mesonephric epithelium development
GO:1901509 regulation of endothelial tube morphogenesis
GO:1902533 positive regulation of intracellular signal transduction
GO:1903672 positive regulation of sprouting angiogenesis
GO:2000347 positive regulation of hepatocyte proliferation
GO:2000544 regulation of endothelial cell chemotaxis to fibroblast growth factor
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005938 cell cortex
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hkn, PDBe:1hkn, PDBj:1hkn
PDBsum1hkn
PubMed12676958
UniProtP05230|FGF1_HUMAN Fibroblast growth factor 1 (Gene Name=FGF1)

[Back to BioLiP]