Structure of PDB 1h15 Chain D Binding Site BS01

Receptor Information
>1h15 Chain D (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFDA
Ligand information
>1h15 Chain F (length=14) Species: 10376 (human gammaherpesvirus 4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGVYHFVKKHVHES
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h15 A Functional and Structural Basis for Tcr Cross-Reactivity in Multiple Sclerosis
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q9 W43 F51 A52 S53 F54 G58 N62 V65 D66 N69 I72
Binding residue
(residue number reindexed from 1)		Q7 W41 F49 A50 S51 F52 G56 N60 V63 D64 N67 I70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h15, PDBe:1h15, PDBj:1h15
PDBsum1h15
PubMed12244309
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]