Structure of PDB 1gt0 Chain D Binding Site BS01

Receptor Information
>1gt0 Chain D (length=79) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKR
PFIDEAKRLRALHMKEHPDYKYRPRRKTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gt0 Crystal Structure of a POU/Hmg/DNA Ternary Complex Suggests Differential Assembly of Oct4 and Sox2 on Two Enhancers
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R5 N8 F10 S31 S34 K35 W41 K42 Y72 R75 R76
Binding residue
(residue number reindexed from 1)		R5 N8 F10 S31 S34 K35 W41 K42 Y72 R75 R76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1gt0, PDBe:1gt0, PDBj:1gt0
PDBsum1gt0
PubMed12923055
UniProtP48432|SOX2_MOUSE Transcription factor SOX-2 (Gene Name=Sox2)

[Back to BioLiP]