Structure of PDB 1f3j Chain D Binding Site BS01

Receptor Information

>1f3j Chain D (length=182) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFG
QLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLL
GQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLS
YLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPE

Ligand information

>1f3j Chain Q (length=14) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AMKRHGLDNYRGYS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1f3j Structural basis of peptide binding and presentation by the type I diabetes-associated MHC class II molecule of NOD mice.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	Y9 L31 I52 L53 F54 N62 A65 E66 H68 N69 R76
Binding residue (residue number reindexed from 1)	Y9 L32 I53 L54 F55 N63 A66 E67 H69 N70 R77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1f3j, PDBe:1f3j, PDBj:1f3j
PDBsum	1f3j
PubMed	10894169
UniProt	P04228\|HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]