Structure of PDB 1bdv Chain D Binding Site BS01

Receptor Information
>1bdv Chain D (length=50) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKGMSKMPQVNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bdv Origins of DNA-binding specificity: role of protein contacts with the DNA backbone.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		M1 G3 M4 S5 N11 S32 V33 N34
Binding residue
(residue number reindexed from 1)		M1 G3 M4 S5 N11 S32 V33 N34
Binding affinityPDBbind-CN: Kd=17nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bdv, PDBe:1bdv, PDBj:1bdv
PDBsum1bdv
PubMed9927650
UniProtP03050|RARC_BPP22 Transcriptional repressor arc (Gene Name=arc)

[Back to BioLiP]