Structure of PDB 1bd2 Chain D Binding Site BS01

Receptor Information
>1bd2 Chain D (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISIS
SIKDKNADGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAAMEGAQKLVF
GQGTRLTINPNIQNPDPAVYQLRDSKSVCLFTDFDSQTNVSQSKDSDVYI
TDKTVLDMRFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Ligand information
>1bd2 Chain C (length=9) Species: 11908 (Human T-cell leukemia virus type I) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLFGYPVYV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bd2 Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M28 D30 M93 G95 A96
Binding residue
(residue number reindexed from 1)		M28 D30 M92 G94 A95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042287 MHC protein binding
GO:0042605 peptide antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bd2, PDBe:1bd2, PDBj:1bd2
PDBsum1bd2
PubMed9586631
UniProtP01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC);
P04437

[Back to BioLiP]