Structure of PDB 1ao7 Chain D Binding Site BS01

Receptor Information
>1ao7 Chain D (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIY
SNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTTDSWGKLQF
GAGTQVVVTPDIQNP
Ligand information
>1ao7 Chain C (length=9) Species: 11908 (Human T-cell leukemia virus type I) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLFGYPVYV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ao7 Structure of the complex between human T-cell receptor, viral peptide and HLA-A2.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q30 S31 D99 S100
Binding residue
(residue number reindexed from 1)		Q30 S31 D93 S94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042605 peptide antigen binding
Biological Process
GO:0002250 adaptive immune response
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ao7, PDBe:1ao7, PDBj:1ao7
PDBsum1ao7
PubMed8906788
UniProtA0A075B6T6|TVAL2_HUMAN T cell receptor alpha variable 12-2 (Gene Name=TRAV12-2);
P01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]