Structure of PDB 1a9n Chain D Binding Site BS01

Receptor Information
>1a9n Chain D (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQA
FVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMR
Ligand information
>1a9n Chain R (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccugguauugcaguaccuccaggu
<<<<<.............>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a9n Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
Resolution2.38 Å
Binding residue
(original residue number in PDB)		Y13 N16 D19 K20 K22 K23 K27 V44 A45 L46 K47 K50 M51 R52 Q54 F56 K80 Q85 A87 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y8 N11 D14 K15 K17 K18 K22 V39 A40 L41 K42 K45 M46 R47 Q49 F51 K75 Q80 A82 K83 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1a9n, PDBe:1a9n, PDBj:1a9n
PDBsum1a9n
PubMed9716128
UniProtP08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)

[Back to BioLiP]