Structure of PDB 9cai Chain Cl Binding Site BS01

Receptor Information
>9cai Chain Cl (length=50) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SALKKSFIKRKLAKKQKQNRPMPQWVRMKTGNTMKYNAKRRHWRRTKLKL
Ligand information
>9cai Chain A8 (length=146) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uagcuucagcgauggaucgguugcaucgaguaucgaugaagaacgcagcu
ugcugcguuacuuaccacgaauugcagagaguggugaaauuucgaacgca
uagcaccaacugggccuccaguugguacgucugguucaggguuguu
........................................<<<<<<.((.
....>>>.....<<<<<<.....)).....>>>>>.>...>>>....<<.
..>><<<<<<<<<....>>>>>>>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9cai High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.
Resolution2.59 Å
Binding residue
(original residue number in PDB)
F8 R11 K12 K15 K18 Q19 R21 P24 W26 M29 K30 T31 M35 N38 K40
Binding residue
(residue number reindexed from 1)
F7 R10 K11 K14 K17 Q18 R20 P23 W25 M28 K29 T30 M34 N37 K39
External links
PDB RCSB:9cai, PDBe:9cai, PDBj:9cai
PDBsum9cai
PubMed39209556
UniProtP52814|RL39_CAEEL Large ribosomal subunit protein eL39 (Gene Name=rpl-39)

[Back to BioLiP]