Structure of PDB 7cgo Chain Ch Binding Site BS01

Receptor Information
>7cgo Chain Ch (length=150) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEH
YSPNGDASKATLRSRQLNISEQVPRSTQRNETSNYEVDRTIRHTKMNVGD
IERLSVAVVVNYKLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFS
Ligand information
>7cgo Chain GK (length=18) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cgo Structural basis of assembly and torque transmission of the bacterial flagellar motor.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		T278 H374
Binding residue
(residue number reindexed from 1)		T47 H93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003774 cytoskeletal motor activity
GO:0005515 protein binding
Biological Process
GO:0071973 bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005886 plasma membrane
GO:0009288 bacterial-type flagellum
GO:0009425 bacterial-type flagellum basal body
GO:0009431 bacterial-type flagellum basal body, MS ring

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cgo, PDBe:7cgo, PDBj:7cgo
PDBsum7cgo
PubMed33882274
UniProtP15928|FLIF_SALTY Flagellar M-ring protein (Gene Name=fliF)

[Back to BioLiP]