Structure of PDB 6xu7 Chain Ch Binding Site BS01

Receptor Information
>6xu7 Chain Ch (length=123) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVV
RKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDA
NRKTLKEIRKRSVFPQRKFAVKA
Ligand information
>6xu7 Chain A8 (length=123) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacucuaagcgguggaucacucggcucaugggucgaugaagaacgcagca
aacugugcgucaucgugugaacugcaggacacaugaacaucgacauuuug
aacgcauaucgcaguccaugcug
........................................<<<.<<.((.
....>>........<<<<.....))...........>>>>......>>>.
...<<.....>>...........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xu7 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		M1 V2 K3 K5 C6 R10 K35 S42 K46 R51 K52 A55 Y58 I59 H62 K66 R89 R92
Binding residue
(residue number reindexed from 1)		M1 V2 K3 K5 C6 R10 K35 S42 K46 R51 K52 A55 Y58 I59 H62 K66 R89 R92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xu7, PDBe:6xu7, PDBj:6xu7
PDBsum6xu7
PubMed34283226
UniProtQ9W499

[Back to BioLiP]