Structure of PDB 6j5k Chain Ca Binding Site BS01

Receptor Information

>6j5k Chain Ca (length=223) Species: 9823 (Sus scrofa)

NENLFASFIAPTMMGLPIVTLIIMFPSLLFPTPKRLINNRTISIQQWLIQ
LTSKQMMAIHNQKGQTWSLMLMSLIMFIGSTNILGLLPHSFTPTTQLSMN
LGMAIPLWSATVFTGFRYKTKTSLAHFLPQGTPALLIPMLVIIETISLFI
QPVALAVRLTANITAGHLLIHLIGGATLALLNINTMTAFITFTILILLTI
LEFAVALIQAYVFTLLVSLYLHD

Ligand information

>6j5k Chain Ck (length=29) Species: 9823 (Sus scrofa)

AAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6j5k Cryo-EM structure of the mammalian ATP synthase tetramer bound with inhibitory protein IF1.
• Resolution: 6.2 Å
• Binding residue (original residue number in PDB): A126 L129 T133 V142
• Binding residue (residue number reindexed from 1): A125 L128 T132 V141

Gene Ontology

Molecular Function

• GO:0015078 proton transmembrane transporter activity
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0006754 ATP biosynthetic process
• GO:0015986 proton motive force-driven ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045259 proton-transporting ATP synthase complex
• GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

External links

• PDB: RCSB:6j5k, PDBe:6j5k, PDBj:6j5k
• PDBsum: 6j5k
• PubMed: 31197009
• UniProt: Q35915|ATP6_PIG ATP synthase subunit a (Gene Name=MT-ATP6)