Structure of PDB 6xu6 Chain CS Binding Site BS01

Receptor Information

>6xu6 Chain CS (length=173) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKF
KKTTGEIVSIKQVYETSPVKIKNFGIWLRYDSRSGTHNMYREYRDLTVGG
AVTQCYRDMGARHRARAHSIQIIKVDSIPAAKTRRVHVKQFHDSKIKFPL
VQRVHHKGNRKLFSFRKPRTYFQ

Ligand information

>6xu6 Chain A7 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccaacgaccauaccacgcugaauacaucgguucucguccgaucaccgaa
auuaagcagcgucgcgggcgguuaguacuuagaugggggaccgcuuggga
acaccgcguguuguuggccu

<<<<<<<<<.....<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>...<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>..>>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6xu6 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	S42 R43 Y46 R49 K52 K53 K55 H122
Binding residue (residue number reindexed from 1)	S38 R39 Y42 R45 K48 K49 K51 H118

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6xu6, PDBe:6xu6, PDBj:6xu6
PDBsum	6xu6
PubMed	34283226
UniProt	P41093\|RL18A_DROME Large ribosomal subunit protein eL20 (Gene Name=RpL18A)

[Back to BioLiP]