Structure of PDB 6xu8 Chain CP Binding Site BS01

Receptor Information

>6xu8 Chain CP (length=185) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAV
IDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEAN
ADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVILT
EKEELVSKATDDEPAKKKLSKKKLQRQKEKMLRSE

Ligand information

>6xu8 Chain A8 (length=123) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacucuaagcgguggaucacucggcucaugggucgaugaagaacgcagca
aacugugcgucaucgugugaacugcaggacacaugaacaucgacauuuug
aacgcauaucgcaguccaugcug

........................................<<<.<<.((.
....>>........<<<<.....))...........>>>>......>>>.
...<<.....>>...........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6xu8 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	S5 R38 R61 N120 Q123
Binding residue (residue number reindexed from 1)	S4 R37 R60 N119 Q122

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6xu8, PDBe:6xu8, PDBj:6xu8
PDBsum	6xu8
PubMed	34283226
UniProt	Q9W3W8\|RL17_DROME Large ribosomal subunit protein uL22 (Gene Name=RpL17)

[Back to BioLiP]