Structure of PDB 6xu8 Chain CN Binding Site BS01

Receptor Information
>6xu8 Chain CN (length=203) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRL
GYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSI
AEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRRDPKINWI
CKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRKNREHMH
RKR
Ligand information
>6xu8 Chain A9 (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcuuggacuacauaugguugaggguugua
..............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xu8 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R38 Q57 Y62 R109 L110 L113 D136 H139
Binding residue
(residue number reindexed from 1)		R37 Q56 Y61 R108 L109 L112 D135 H138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xu8, PDBe:6xu8, PDBj:6xu8
PDBsum6xu8
PubMed34283226
UniProtO17445|RL15_DROME Large ribosomal subunit protein eL15 (Gene Name=RpL15)

[Back to BioLiP]