Structure of PDB 7nql Chain CL Binding Site BS01

Receptor Information
>7nql Chain CL (length=45) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTL
Ligand information
>7nql Chain DL (length=27) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IQQLVQDIASLTLLEISDLNELLKKTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nql Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		P25 K27 I28 L31 D34 L46
Binding residue
(residue number reindexed from 1)		P16 K18 I19 L22 D25 L37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006390 mitochondrial transcription
GO:0006412 translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nql, PDBe:7nql, PDBj:7nql
PDBsum7nql
PubMed33878294
UniProtA0A4X1U6S6

[Back to BioLiP]