Structure of PDB 6ydw Chain CL Binding Site BS01

Receptor Information
>6ydw Chain CL (length=45) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTL
Ligand information
>6ydw Chain DL (length=27) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IQQLVQDIASLTLLEISDLNELLKKTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ydw Structural insights into mammalian mitochondrial translation elongation catalyzed by mtEFG1.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		Y60 K63 I64 L82
Binding residue
(residue number reindexed from 1)		Y15 K18 I19 L37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006390 mitochondrial transcription
GO:0006412 translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ydw, PDBe:6ydw, PDBj:6ydw
PDBsum6ydw
PubMed32602580
UniProtA0A4X1U6S6

[Back to BioLiP]