Structure of PDB 6xu7 Chain CL Binding Site BS01

Receptor Information

>6xu7 Chain CL (length=210) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPAS
GALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRR
KNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLKG
PVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRAKRAKE
AAESEDAAKG

Ligand information

>6xu7 Chain A8 (length=123) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacucuaagcgguggaucacucggcucaugggucgaugaagaacgcagca
aacugugcgucaucgugugaacugcaggacacaugaacaucgacauuuug
aacgcauaucgcaguccaugcug

........................................<<<.<<.((.
....>>........<<<<.....))...........>>>>......>>>.
...<<.....>>...........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6xu7 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
Resolution	4.9 Å
Binding residue (original residue number in PDB)	F25 N26
Binding residue (residue number reindexed from 1)	F24 N25

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6xu7, PDBe:6xu7, PDBj:6xu7
PDBsum	6xu7
PubMed	34283226
UniProt	P41126\|RL13_DROME Large ribosomal subunit protein eL13 (Gene Name=RpL13)

[Back to BioLiP]