Structure of PDB 6sg9 Chain CK Binding Site BS01

Receptor Information
>6sg9 Chain CK (length=40) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKYRRVPMLLKPQQGGQQYFNHFLIRSTNDRLTQQDVDNA
Ligand information
>6sg9 Chain CA (length=146) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaauuauauuauauuauauuuauucauauaauuaauaggauaauauuugu
aguuuuugauaccaugauaaggauuauaaauugaaaguguuaauaucaua
aucaaaauuuauuauuuauauuaaauauguauguguagauaaaaua
........<<<<.....<<.<<...<<<......................
...............<.<<<.<.<...........>.>.>>>.>......
.........>>>....>>.>>.............>>>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sg9 Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		D23 P29 M30
Binding residue
(residue number reindexed from 1)		D1 P7 M8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sg9, PDBe:6sg9, PDBj:6sg9
PDBsum6sg9
PubMed31515389
UniProtQ389T7

[Back to BioLiP]