Structure of PDB 6hiz Chain CK Binding Site BS01

Receptor Information
>6hiz Chain CK (length=52) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRGKPRPRAGMFPDKYRRVPMLLKPQQGGQQYFNHFLIRSTNDRLTQQDV
DN
Ligand information
>6hiz Chain CA (length=143) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uauuauauuuauucauauaauuaauaggauaauauuuguaguuuuugaua
ccaugauaaggauuauaaauugaaaguguuaauaucauaaucaaaauuua
uuauuuauauuaaauauguauguguagauaaaauaagaaauua
.......<<<<<......................................
..................................................
...........................>>>>>...........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hiz Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
Resolution3.08 Å
Binding residue
(original residue number in PDB)		R10 R11 P14 R15 P16 R17 A18 G19 M20 F21 P22 K24 Y25 R26 R27
Binding residue
(residue number reindexed from 1)		R1 R2 P5 R6 P7 R8 A9 G10 M11 F12 P13 K15 Y16 R17 R18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hiz, PDBe:6hiz, PDBj:6hiz
PDBsum6hiz
PubMed30213880
UniProtQ389T7

[Back to BioLiP]