BioLiP

Receptor Information

>8pvk Chain CI (length=152) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SQPGVMYIARLPHGFYEHELRGYFSQFGEITRLRVVRNKKTGASRHRAFI
EFADAEVADIAARTMDKYLLFGHILTCKIVPPAQVHPDLFKGANRRFKVV
PWNKMAGRQLERPLSESQWQVKVAKEEQRRAARAEKLKEMGYEFEAPALK
VP

>8pvk Chain C3 (length=82) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uucaaccaucaagcccugggcuuguguuggggacccgcggcugcucgcgg
gcccugaaaagcaguggcgggcgugccagccg

.........<<<<<.....>>>>>....<<<<.<<<<<<<....>>>>>>
>>>>>.........<<<<<<<..>.>>.>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pvk Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	Y190 R193 H201 R217 V218 V219 R220 N221 K222 K223 S227 R228 H229 R230 F254 H256 H269 D271 L272 G275 A276 R278 R279 F280 K281 V283 W285 N286 M288 R291 K305 K308 R312 R316
Binding residue (residue number reindexed from 1)	Y7 R10 H18 R34 V35 V36 R37 N38 K39 K40 S44 R45 H46 R47 F71 H73 H86 D88 L89 G92 A93 R95 R96 F97 K98 V100 W102 N103 M105 R108 K122 K125 R129 R133

Enzyme Commision number

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005730	nucleolus

PDB	RCSB:8pvk, PDBe:8pvk, PDBj:8pvk
PDBsum	8pvk
PubMed	37921038
UniProt	G0S1H0

[Back to BioLiP]

Structure of PDB 8pvk Chain CI Binding Site BS01