Structure of PDB 6rxv Chain CF Binding Site BS01

Receptor Information
>6rxv Chain CF (length=120) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAWPKAEDPALVQELLDCVQQASHYRQLKKGANETTKSVNRGTSELVILA
ADTQPLSIVLHIPLICEEKNVPYVYVPSKVALGRACGVSRAVIAVSLTSN
EASDLNSKIRALRDKVERLA
Ligand information
>6rxv Chain C2 (length=230) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgacaauacuucagagaaucauuucuauaguaguuguccucucuugug
uuuccuaaaggagccacagaucccacccggguugaugaacgagauccucg
gcgccagugagguccauuuacucucgcucuaccugcaaagguggcggucg
cgugccucgucucgcggcuguauagagaguggcgaugaucuguaccccgc
ggggugggugucgauggaagucugaccggc
..................................................
..........................<<<<......<.......<<<<<<
<<<<.<<............<<<<<<...<<<<<<....>>>>>><<<<<<
<<.<......>.>>>>>>>>....>>>>>>.........>>.<<<<<<..
>>>>>>.>>>>>>>.>>>...>...>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rxv Thermophile 90S Pre-ribosome Structures Reveal the Reverse Order of Co-transcriptional 18S rRNA Subdomain Integration.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		G37 A38 N39 E40 K43 R47 T59 Q60 V94 S95 R96 V98 I99
Binding residue
(residue number reindexed from 1)		G31 A32 N33 E34 K37 R41 T53 Q54 V88 S89 R90 V92 I93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000470 maturation of LSU-rRNA
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rxv, PDBe:6rxv, PDBj:6rxv
PDBsum6rxv
PubMed31378463
UniProtG0SGM0

[Back to BioLiP]