Structure of PDB 7nze Chain CCC Binding Site BS01

Receptor Information
>7nze Chain CCC (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLREFGRF
ASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELRE
PNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYL
PFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nze Key interactions in the trimolecular complex consisting of the rheumatoid arthritis-associated DRB1*04:01 molecule, the major glycosylated collagen II peptide and the T-cell receptor.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		Q9 S53 F54 N62 N69 I72
Binding residue
(residue number reindexed from 1)		Q8 S52 F53 N61 N68 I71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nze, PDBe:7nze, PDBj:7nze
PDBsum7nze
PubMed35027402
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]