Structure of PDB 6sg9 Chain CC Binding Site BS01

Receptor Information
>6sg9 Chain CC (length=74) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFLIHFVHYKTILQKYTFKFKHIFLSIDKYNSLFFNISGILIWLNIIHIN
IILIKYSFFILINNFEYLIILIST
Ligand information
>6sg9 Chain Uf (length=9) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sg9 Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K29 Y30 N31 S32
Binding residue
(residue number reindexed from 1)		K29 Y30 N31 S32
External links