Structure of PDB 7spb Chain C5 Binding Site BS01

Receptor Information
>7spb Chain C5 (length=217) Species: 90370 (Salmonella enterica subsp. enterica serovar Typhi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSPATISLPQGGQFRLSISNTDPNMIFIPGDKVTAITAPGGMLADKRLTR
AGGVLFTSVATRTFTIFVETARGQTFSVVATPVKGEGRVYRLMSAEPPSR
PETRKWETAQAYEKLLISLNRAVLTGDIPDGYGEVKPLSDGIRLPGGFSV
TPLKAWAGDQLRADRYELRNANTWGVALREQDFWKPGVRAVMFDNNAQTL
MGGGRMTVTVIRGNGEG
Ligand information
>7spb Chain E5 (length=11) Species: 90370 (Salmonella enterica subsp. enterica serovar Typhi) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPGMMDSQEFS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7spb Structure of a type IV secretion system core complex encoded by multi-drug resistance F plasmids
Resolution3.31 Å
Binding residue
(original residue number in PDB)		T58 A59 I60 T61 A62 G64 K70 L72
Binding residue
(residue number reindexed from 1)		T34 A35 I36 T37 A38 G40 K46 L48
Enzymatic activity
Enzyme Commision number ?
External links