Structure of PDB 9c3t Chain C Binding Site BS01

Receptor Information
>9c3t Chain C (length=250) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPSGIELHNRDFLTDAAHLPDASIDLIVADPPYGLGKDYGNDSDKRSGDD
FLAWTREWLELAIPKLKPSGSMYIFCTWQYAPEIFSFLKTQLTMVNEIIW
DRRVPSMGGTTRRFTSVHDNIGFFAVSRAYYFDLDPVRIPYDADTKKARS
RKLFEGSKWLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLA
SCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCAIAHERVNALA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c3t Burkholderia cenocepacia epigenetic regulator M.BceJIV simultaneously engages two DNA recognition sequences for methylation.
Resolution2.37 Å
Binding residue
(original residue number in PDB)		P60 P61 Y62 L64 K66 D73 W107 Q108 V133 S135 M136 G137 G138 T139 R141 S145 D148 R203 H205 R206 Q207 R211 T216 K218
Binding residue
(residue number reindexed from 1)		P31 P32 Y33 L35 K37 D44 W78 Q79 V104 S106 M107 G108 G109 T110 R112 S116 D119 R174 H176 R177 Q178 R182 T187 K189
External links