Structure of PDB 9bju Chain C Binding Site BS01

Receptor Information
>9bju Chain C (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH
SYRGHLWLFRDAGTHDGLLVNQTELFVPSLNQPIFANITLPVYTLKERCL
QVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9bju Potency-enhanced peptidomimetic VHL ligands with improved oral bioavailability
Resolution2.47 Å
Binding residue
(original residue number in PDB)
F76 P86 W88 Y98 P99 I109 H110 S111 Y112 H115 W117
Binding residue
(residue number reindexed from 1)
F16 P26 W28 Y38 P39 I49 H50 S51 Y52 H55 W57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:9bju, PDBe:9bju, PDBj:9bju
PDBsum9bju
PubMed
UniProtP40337|VHL_HUMAN von Hippel-Lindau disease tumor suppressor (Gene Name=VHL)

[Back to BioLiP]