Structure of PDB 9b12 Chain C Binding Site BS01

Receptor Information
>9b12 Chain C (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQM
EVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFE
Ligand information
>9b12 Chain G (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RGRWACQSCTFENEAAAVLCSICERPRLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b12 Linkage and substrate specificity conferred by NZF ubiquitin binding domains
Resolution1.81 Å
Binding residue
(original residue number in PDB)
E434 L437 A438 Q441 D445
Binding residue
(residue number reindexed from 1)
E16 L19 A20 Q23 D27
External links
PDB RCSB:9b12, PDBe:9b12, PDBj:9b12
PDBsum9b12
PubMed
UniProtQ96CV9|OPTN_HUMAN Optineurin (Gene Name=OPTN)

[Back to BioLiP]