Structure of PDB 8zkm Chain C Binding Site BS01

Receptor Information
>8zkm Chain C (length=202) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKATLVKTIAYRMGNVKGQDTAIDFELALSIERLEGQEFVPWFLLSENN
FFEGTAQENRIPVPRGFIREYEEGSLYLRRVAGTGKCLIKKSQDQLLKYE
GMTGEPSHYSLTNQYFRIYPVPQEDFKVELLFYRKSSTLNVEDNPWYEYA
AELLVAETIWAMLSARRDKMADYWKSVAADQMRRLTILDAERRLANQEIF
MG
Ligand information
>8zkm Chain A (length=19) Species: 666 (Vibrio cholerae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YDWGRPVKPVGSDWSTDTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8zkm Three-dimensional structures of Vibrio cholerae typing podophage VP1 in two states
Resolution6.7 Å
Binding residue
(original residue number in PDB)		N49 N50 F51 F52 E58 R60 P62 P64 Y115
Binding residue
(residue number reindexed from 1)		N49 N50 F51 F52 E58 R60 P62 P64 Y115
External links